PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032309m
Common NameCICLE_v10032309mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 287aa    MW: 32216 Da    PI: 9.4836
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032309mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.46.8e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++ +  ++G+g+W+ I+r     +t+ q+ s+ qky
  Ciclev10032309m 126 PWTEEEHKRFLMGLIKYGKGDWRNISRNYVISKTPTQVASHAQKY 170
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.3012277IPR017884SANT domain
SMARTSM007174.3E-72375IPR001005SANT/Myb domain
SuperFamilySSF466893.36E-112579IPR009057Homeodomain-like
CDDcd001673.92E-62672No hitNo description
PfamPF002491.3E-52671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-10117175IPR009057Homeodomain-like
PROSITE profilePS5129419.737119175IPR017930Myb domain
SuperFamilySSF466891.35E-15121174IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17122174IPR006447Myb domain, plants
SMARTSM007176.0E-11123173IPR001005SANT/Myb domain
PfamPF002496.5E-11126170IPR001005SANT/Myb domain
CDDcd001673.40E-9126171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
METLYPASYM SNSSNWFLQD SSRSTSWTRE ENKRFESALA IYSESTPDRW IKVAAMIPGK  60
TVLDVIKQYK ELEEDVSDIE AGRVPIPGYL SSSFTLELVS ESDYDANRKR TLVAKSSDHE  120
RKKGVPWTEE EHKRFLMGLI KYGKGDWRNI SRNYVISKTP TQVASHAQKY FIRQLSGGKD  180
KRRPSIHDIT TGNLTNSVSS DNHKPSSFDQ SNVIPAQQKS FGTPKVGLEW TDSNNGAVMA  240
SDSTQSNMLM PSAFEFGSHG LKLQGQNLYA TTAYHGAHVK PRNPFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1527971181RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435669.10.0hypothetical protein CICLE_v10032309mg
RefseqXP_006486372.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-96DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV4V9N20.0V4V9N2_9R
STRINGPOPTR_0010s20040.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-96MYB family protein